Host taxon 10090
Protein NP_663387.3
chromosome transmission fidelity protein 8 homolog
Mus musculus
Gene Chtf8, UniProt P0CG15
>NP_663387.3|Pseudomona aeruginosa PA01|chromosome transmission fidelity protein 8 homolog
MVQIVISSTGAEGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKTIHLEKPFAVLVKHTPGKQDCDEPGRGTGTQYLVTALIKNKILFKTRPKPIITNVPKKV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.52 | -1.51729985773638 | 7.0e-25 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)