Host taxon 10090
Protein NP_080059.2
charged multivesicular body protein 3 isoform 1
Mus musculus
Gene Chmp3, UniProt Q9CQ10
>NP_080059.2|Pseudomona aeruginosa PA01|charged multivesicular body protein 3 isoform 1
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEPAGAMAASEEGEEEEDEEDLEAMQSRLATLRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.79 | -0.792148291606691 | 9.9e-10 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)