Host taxon 10090
Protein NP_848762.1
CGG triplet repeat-binding protein 1
Mus musculus
Gene Cggbp1, UniProt Q8BHG9
>NP_848762.1|Pseudomona aeruginosa PA01|CGG triplet repeat-binding protein 1
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSPAQTEKASVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLSSQDC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.45 | 0.44803208881032 | 7.2e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)