Host taxon 10090
Protein NP_077792.2
ceramide-1-phosphate transfer protein
Mus musculus
Gene Cptp, UniProt Q8BS40
>NP_077792.2|Pseudomona aeruginosa PA01|ceramide-1-phosphate transfer protein
MDDSEKDFNLKVVLVSFKQCLTDKGEVLLDHYIAGWKGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSSPQSEHYASLQSMVAYEVSNKLVDMDHRSHPRHPHSGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLCSEAYNATLANYHSWIVRQAVTVAFCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHVYDISQKLYAEHSLLDLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.94 | -0.943994595612376 | 0.006 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)