Host taxon 10090
Protein NP_080168.1
centrosomal protein of 19 kDa
Mus musculus
Gene Cep19, UniProt Q9CQA8
>NP_080168.1|Pseudomona aeruginosa PA01|centrosomal protein of 19 kDa
MKYIAKKCGVRFQPPAVILIYENETEGKSRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVPLKQLEKLFVFLRGSLQGQSLAETMEQIRRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKRKDDPTFVYDVEVEFPQDEQLLSCSWDTASVDDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.28 | -1.28401465143168 | 0.0042 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)