Host taxon 10090
Protein NP_083862.1
centrosomal protein of 112 kDa isoform 1
Mus musculus
Gene Cep112, UniProt Q5PR68
>NP_083862.1|Pseudomona aeruginosa PA01|centrosomal protein of 112 kDa isoform 1
MRPLRDTGPSVPKENMALQDELETRSHQVRSAEKKLHHKELEAQEQIMYIRQEYETKFKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQSRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.38 | -2.37837192703685 | 0.00054 | 32071273 | |
Retrieved 1 of 4 entries in 1.2 ms
(Link to these results)