Host taxon 10090
Protein NP_062278.2
centrin-2
Mus musculus
Gene Cetn2, UniProt Q9R1K9
>NP_062278.2|Pseudomona aeruginosa PA01|centrin-2
MASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.23 | -1.23394213736626 | 0.00068 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)