Bacterial taxon 208964
Protein WP_003091581.1
cell division topological specificity factor MinE
Pseudomona aeruginosa PA01
Gene minE, UniProt Q9HYZ5
>WP_003091581.1|Pseudomona aeruginosa PA01|cell division topological specificity factor MinE
MSLLDFFRSRKSQNSASIAKERLQIIVAHERGQRAQPDYLPQLQKDLLEVIRKYVPIDQEQIQVELENQGNCSILELNITLPDR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ -0.45 | -0.447398276932954 | 0.00014 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)