Host taxon 10090
Protein NP_079946.2
cell death-inducing p53-target protein 1 isoform 4
Mus musculus
Gene Cdip1, UniProt Q9DB75
>NP_079946.2|Pseudomona aeruginosa PA01|cell death-inducing p53-target protein 1 isoform 4
MSNEPPPPYPGGPTAPLLEEKSGAPLTPGRTSPAVMQPPPGMPLPSADIAPPPYEPPGQPVPQPGFVPPHMNADGTYMPAGFYPPPGPHPPMGYYPPGPYPPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKRLC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.8 | -0.804504948579485 | 7.3e-6 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)