Host taxon 10090
Protein NP_084252.1
CDKN2AIP N-terminal-like protein
Mus musculus
Gene Cdkn2aipnl, UniProt Q9D211
>NP_084252.1|Pseudomona aeruginosa PA01|CDKN2AIP N-terminal-like protein
MVGGEASAAVEKLVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGGGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMRKHQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.7 | -0.697447329766367 | 0.016 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)