Host taxon 10090
Protein NP_001078969.2
CDGSH iron-sulfur domain-containing protein 3, mitochondrial isoform 2 precursor
Mus musculus
Gene Cisd3, UniProt B1AR13
>NP_001078969.2|Pseudomona aeruginosa PA01|CDGSH iron-sulfur domain-containing protein 3, mitochondrial isoform 2 precursor
MGFRRLSFPTDFIFLFPNHICLPALSKPYQRREISSWLARWFPKDPAKPVVAQKTPIRLELVAGKTYRWCVCGRSKNQPFCDGSHFFQRTGLSPLKFKAQETRTVALCTCKATQRPPYCDGTHKSEQVQKAEVGSPL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.61 | -1.60613280499439 | 0.024 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)