Host taxon 10090
Protein NP_598768.1
CDGSH iron-sulfur domain-containing protein 1
Mus musculus
Gene Cisd1, UniProt Q91WS0
>NP_598768.1|Pseudomona aeruginosa PA01|CDGSH iron-sulfur domain-containing protein 1
MGLSSNSAVRVEWIAAVTFAAGTAALGYLAYKKFYAKENRTKAMVNLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.03 | -1.03001921409575 | 0.0046 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)