Host taxon 10090
Protein NP_848741.1
CDC42 small effector protein 2
Mus musculus
Gene Cdc42se2, UniProt Q8BGH7
>NP_848741.1|Pseudomona aeruginosa PA01|CDC42 small effector protein 2
MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.28 | 0.277738841731902 | 0.0093 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)