Host taxon 10090
Protein NP_001033797.1
CDC42 small effector protein 1
Mus musculus
Gene Cdc42se1, UniProt Q8BHL7
>NP_001033797.1|Pseudomona aeruginosa PA01|CDC42 small effector protein 1
MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNHRDRPWSNSRAL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.47 | 0.471111130466644 | 1.3e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)