Host taxon 10090
Protein NP_067429.1
cdc42 effector protein 5
Mus musculus
Gene Cdc42ep5, UniProt Q9Z0X0
>NP_067429.1|Pseudomona aeruginosa PA01|cdc42 effector protein 5
MPVMKQLGPAQPKKRLDRGALSISAPLGDFRHTLHVGRGGDAFGDTSFLSRHGGGPPPEPGAPPVVAPHSVAPPAAPQPPVAVPSPADPLLSFHLDLGPSMLDAVLGVMDAERSETTATKPDGDAHPRVQHPKTRCCSNADLQLDDVIGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.01 | -1.01099663898653 | 0.037 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)