Host taxon 10090
Protein NP_001106862.1
CD247 antigen isoform zeta precursor
Mus musculus
Gene Cd247, UniProt P24161
>NP_001106862.1|Pseudomona aeruginosa PA01|CD247 antigen isoform zeta precursor
MKWKVSVLACILHVRFPGAEAQSFGLLDPKLCYLLDGILFIYGVIITALYLRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.85 | 0.849388213227242 | 0.029 | 32071273 | |
Retrieved 1 of 3 entries in 1.8 ms
(Link to these results)