Host taxon 10090
Protein NP_084137.1
CB1 cannabinoid receptor-interacting protein 1
Mus musculus
Gene Cnrip1, UniProt Q5M8N0
>NP_084137.1|Pseudomona aeruginosa PA01|CB1 cannabinoid receptor-interacting protein 1
MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.14 | -2.14273717528145 | 0.00024 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)