Host taxon 10090
Protein NP_058596.1
caveolin-2 isoform 1
Mus musculus
Gene Cav2, UniProt Q9WVC3
>NP_058596.1|Pseudomona aeruginosa PA01|caveolin-2 isoform 1
MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQLNSHLKLGFEDLIAEPETTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVVIGPLCTSVGRSFSSVSMQLSHD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.44 | -1.43663273426528 | 2.5e-43 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)