Host taxon 10090
Protein NP_034051.2
cathelicidin antimicrobial peptide precursor
Mus musculus
Gene Camp, UniProt P51437
>NP_034051.2|Pseudomona aeruginosa PA01|cathelicidin antimicrobial peptide precursor
MQFQRDVPSLWLWRSLSLLLLLGLGFSQTPSYRDAVLRAVDDFNQQSLDTNLYRLLDLDPEPQGDEDPDTPKSVRFRVKETVCGKAERQLPEQCAFKEQGVVKQCMGAVTLNPAADSFDISCNEPGAQPFRFKKISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 8.27 | 8.27195874824976 | 2.7e-10 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)