Host taxon 10090
Protein NP_081014.1
caspase recruitment domain-containing protein 19
Mus musculus
Gene Card19, UniProt Q9D1I2
>NP_081014.1|Pseudomona aeruginosa PA01|caspase recruitment domain-containing protein 19
MTDQTYCDRLVQDTPFLTGQGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQQRGERHCQEFYRALYIHAQPLHSHLPSRYSPQNSDCRELDWGIESRELSDRGPMSFLAGLGLAAGLALLLYCCPPDPKVLPGTRRVLAFSPVIIDRHVSRYLLAFLADDLGGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 1 | 0.998555287589513 | 0.00039 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)