Host taxon 10090
Protein NP_001034139.1
cAMP-dependent protein kinase inhibitor beta isoform 2
Mus musculus
Gene Pkib, UniProt Q3TZU5
>NP_001034139.1|Pseudomona aeruginosa PA01|cAMP-dependent protein kinase inhibitor beta isoform 2
MRTDSSEMTDVESVITSFASSARAGRRNALPDIQSSLATSGSSDLPLKLEALAVKEDAKTKNEEKDQGQPKTPLNEGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.93 | 0.927179308653984 | 0.05 | 32071273 | |
Retrieved 1 of 4 entries in 1.3 ms
(Link to these results)