Host taxon 10090
Protein NP_032888.1
cAMP-dependent protein kinase inhibitor alpha
Mus musculus
Gene Pkia, UniProt P63248
>NP_032888.1|Pseudomona aeruginosa PA01|cAMP-dependent protein kinase inhibitor alpha
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEDDGQRSSTEQSGEAQGEAAKSES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.37 | -1.36602930316694 | 2.4e-7 | 32071273 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)