Host taxon 10090
Protein NP_612177.1
calmodulin-like protein 4 isoform a
Mus musculus
Gene Calml4, UniProt Q91WQ9
>NP_612177.1|Pseudomona aeruginosa PA01|calmodulin-like protein 4 isoform a
MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHKEVDDLFKEAGIEPNGQVKYDTFIQRITIPVRDY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.6 | -1.60362415797596 | 0.011 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)