Host taxon 10090
Protein NP_083617.2
calcyphosin-like protein
Mus musculus
Gene Capsl, UniProt Q6P8Y1
>NP_083617.2|Pseudomona aeruginosa PA01|calcyphosin-like protein
MAGTARHDREMAIQSKKKLSTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDNNNRTLDFKEFLKGLNDYAVVMEKEEAEELFQRFDRDGSGTIDFNEFLLTLRPPMSRARKEVIMKAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMTTAWKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.06 | -2.06083244575992 | 0.00015 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)