Host taxon 10090
Protein NP_079727.1
calcium/calmodulin-dependent protein kinase II inhibitor 1
Mus musculus
Gene Camk2n1, UniProt Q6QWF9
>NP_079727.1|Pseudomona aeruginosa PA01|calcium/calmodulin-dependent protein kinase II inhibitor 1
MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.58 | 0.579369493614249 | 0.00096 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)