Host taxon 10090
Protein NP_077779.2
calcineurin subunit B type 1
Mus musculus
Gene Ppp3r1, UniProt Q63810
>NP_077779.2|Pseudomona aeruginosa PA01|calcineurin subunit B type 1
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.58 | 0.577518069290659 | 1.4e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)