Host taxon 10090
Protein NP_032625.2
C-X-C motif chemokine 9 precursor
Mus musculus
Gene Cxcl9, UniProt P18340
>NP_032625.2|Pseudomona aeruginosa PA01|C-X-C motif chemokine 9 precursor
MKSAVLFLLGIIFLEQCGVRGTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 8.35 | 8.34601289730589 | 6.6e-83 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)