Host taxon 10090
Protein NP_705804.2
C-X-C motif chemokine 17 precursor
Mus musculus
Gene Cxcl17, UniProt Q5UW37
>NP_705804.2|Pseudomona aeruginosa PA01|C-X-C motif chemokine 17 precursor
MKLLASPFLLLLPVMLMSMVFSSPNPGVARSHGDQHLAPRRWLLEGGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQQFLKRCHLASFALPL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.1 | -1.09825907185965 | 3.8e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)