Host taxon 10090
Protein NP_035469.1
C-X-C motif chemokine 15 precursor
Mus musculus
Gene Cxcl15, UniProt Q9WVL7
>NP_035469.1|Pseudomona aeruginosa PA01|C-X-C motif chemokine 15 precursor
MAAQGWSMLLLAVLNLGIFVRPCDTQELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.94 | -2.94204576274935 | 1.5e-8 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)