Host taxon 10090
Protein NP_062514.2
C-X-C motif chemokine 14 precursor
Mus musculus
Gene Cxcl14, UniProt Q9WUQ5
>NP_062514.2|Pseudomona aeruginosa PA01|C-X-C motif chemokine 14 precursor
MRLLAAALLLLLLALCASRVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.88 | 0.884283069632071 | 3.8e-19 | 32071273 | |
Retrieved 1 of 2 entries in 1.9 ms
(Link to these results)