Host taxon 10090
Protein NP_061354.1
C-X-C motif chemokine 13 precursor
Mus musculus
Gene Cxcl13, UniProt O55038
>NP_061354.1|Pseudomona aeruginosa PA01|C-X-C motif chemokine 13 precursor
MRLSTATLLLLLASCLSPGHGILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.09 | 1.09309078457152 | 0.0066 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)