Host taxon 10090
Protein NP_001296566.1
C-type lectin domain family 7 member A isoform 2
Mus musculus
Gene Clec7a, UniProt V9GXI5
>NP_001296566.1|Pseudomona aeruginosa PA01|C-type lectin domain family 7 member A isoform 2
MKYHSHIENLDEDGYTQLDFSTQDIHKRPRGSEKGSQAPSSPWRPIAVGLGILCFVVVVVAAVLGALGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.58 | -0.584664317979494 | 1.8e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)