Host taxon 10090
Protein NP_001177249.1
C-type lectin domain family 6 member A isoform 2
Mus musculus
Gene Clec4n, UniProt Q3U3M9
>NP_001177249.1|Pseudomona aeruginosa PA01|C-type lectin domain family 6 member A isoform 2
MVQERQSQVTYQFIMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.91 | -0.908422876425404 | 0.013 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)