Host taxon 10090
Protein NP_001156633.1
C-type lectin domain family 4 member D isoform 2
Mus musculus
Gene Clec4d, UniProt Q9Z2H6
>NP_001156633.1|Pseudomona aeruginosa PA01|C-type lectin domain family 4 member D isoform 2
MWLEESQMKSKGTRHPQLIPCVFAVVSISFLSACFISTCLVTHHYFLRWTRGSVVKLSDYHTRVTCIREEPQPGATGTWTCCPVSWRAFQSNCYFPLNDNQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLDKRFSYFLGLADENVEGQWQWVDKTPFNPHTVFWEKGESNDFMEEDCVVLVHVHEKWVWNDFPCHFEVRRICKLPGITFNWKPSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.74 | 5.74078083585356 | 6.6e-162 | 32071273 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)