Host taxon 10090
Protein NP_038681.2
C-C motif chemokine 5 precursor
Mus musculus
Gene Ccl5, UniProt P30882
>NP_038681.2|Pseudomona aeruginosa PA01|C-C motif chemokine 5 precursor
MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.46 | 2.46141230098159 | 1.6e-27 | 32071273 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)