Host taxon 10090
Protein NP_001153210.1
C-C motif chemokine 20 isoform 2 precursor
Mus musculus
Gene Ccl20, UniProt O89093
>NP_001153210.1|Pseudomona aeruginosa PA01|C-C motif chemokine 20 isoform 2 precursor
MACGGKRLLFLALAWVLLAHLCSQAEASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 7.62 | 7.62419313970803 | 1.2e-115 | 32071273 | |
Retrieved 1 of 3 entries in 2 ms
(Link to these results)