Host taxon 10090
Protein NP_081284.2
BTB/POZ domain-containing protein KCTD5
Mus musculus
Gene Kctd5, UniProt Q8VC57
>NP_081284.2|Pseudomona aeruginosa PA01|BTB/POZ domain-containing protein KCTD5
MAENHCELLPPAPSGLGAGLGGGLCRRCSAGMGALAQRPGGVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKISQMPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTTSEPSEKAKILQERGSRM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.6 | 0.59688991274728 | 0.0056 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)