Host taxon 10090
Protein NP_001276600.1
BTB/POZ domain-containing protein KCTD17 isoform 1
Mus musculus
Gene Kctd17, UniProt E0CYD2
>NP_001276600.1|Pseudomona aeruginosa PA01|BTB/POZ domain-containing protein KCTD17 isoform 1
MQTTRPAMRMEAGEAAPPVGAGGRPGGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVAQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSSPHGLSSESTRKAKPCHLRIPLTFSPSHHRLLLLRFLLEVPVRTLPDPSLSLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.33 | -1.32755967789773 | 1.6e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)