Host taxon 10090
Protein NP_598873.2
BTB/POZ domain-containing protein KCTD1 isoform 2
Mus musculus
Gene Kctd1, UniProt Q5M956
>NP_598873.2|Pseudomona aeruginosa PA01|BTB/POZ domain-containing protein KCTD1 isoform 2
MFQDSRPNMSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.75 | 0.747455209861953 | 0.00013 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)