Host taxon 10090
Protein NP_035256.2
BPI fold-containing family A member 1 precursor
Mus musculus
Gene Bpifa1, UniProt P97361
>NP_035256.2|Pseudomona aeruginosa PA01|BPI fold-containing family A member 1 precursor
MFLVGSLVVLCGLLAHSTAQLAGLPLPLGQGPPLPLNQGPPLPLNQGQLLPLAQGLPLAVSPALPSNPTDLLAGKFTDALSGGLLSGGLLGILENIPLLDVIKSGGGNSNGLVGGLLGKLTSSVPLLNNILDIKITDPQLLELGLVQSPDGHRLYVTIPLGLTLNVNMPVVGSLLQLAVKLNITAEVLAVKDNQGRIHLVLGDCTHSPGSLKISLLNGVTPVQSFLDNLTGILTKVLPELIQGKVCPLVNGILSGLDVTLVHNIAELLIHGLQFVIKV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.78 | 0.779937747664189 | 1.9e-11 | 32071273 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)