Host taxon 10090
Protein NP_932763.1
bone marrow stromal antigen 2 precursor
Mus musculus
Gene Bst2, UniProt Q8R2Q8
>NP_932763.1|Pseudomona aeruginosa PA01|bone marrow stromal antigen 2 precursor
MAPSFYHYLPVPMDEMGGKQGWGSHRQWLGAAILVVLFGVTLVILTIYFAVTANSVACRDGLRAQAECRNTTHLLQRQLTRTQDSLLQAETQANSCNLTVVTLQESLEKKVSQALEQQARIKELENEVTKLNQELENLRIQKETSSTVQVNSGSSMVVSSLLVLKVSLFLLF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.02 | 1.01976376144792 | 3.9e-5 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)