Host taxon 10090
Protein NP_001139024.1
BLOC-1-related complex subunit 8 isoform 1
Mus musculus
Gene Borcs8, UniProt Q9D6Y4
>NP_001139024.1|Pseudomona aeruginosa PA01|BLOC-1-related complex subunit 8 isoform 1
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKSLVDSSVYFRSVEGLLKQAISIRDHMNTSAQGHSQEKLSPPPSLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.75 | -1.75433290643333 | 3.6e-8 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)