Host taxon 10090
Protein NP_001163950.1
BLOC-1-related complex subunit 5 isoform 1
Mus musculus
Gene Borcs5, UniProt Q9D920
>NP_001163950.1|Pseudomona aeruginosa PA01|BLOC-1-related complex subunit 5 isoform 1
MPVPLRTATLVYRHLEPRKQVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFCFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSMLPEAERLEPFSMKPERERH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.43 | 1.43081694050495 | 2.8e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)