Host taxon 10090
Protein NP_598485.1
biogenesis of lysosome-related organelles complex 1 subunit 4
Mus musculus
Gene Bloc1s4, UniProt Q8VED2
>NP_598485.1|Pseudomona aeruginosa PA01|biogenesis of lysosome-related organelles complex 1 subunit 4
MEEGPAVGTLSREVSTEEAEPLGAAWSGDSGHVSQSHSSASGPWDDDGPEDAPGRDLPLLRRAASGYASSLLPSAGPRPEVEALDASLEELLAKVDEFVGMLDMIRGDSSHVVGEGVPRIHAKAAEMRRIYGRIDKLEAFVRMIGSSVARMEEQVAKAEAELGTFPRAFRRLLHTISVPALFRSAPSGPQRAAYEPPVLFRTEDHFPGCGDRPQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.36 | 1.35978087323344 | 1.6e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)