Host taxon 10090
Protein NP_033878.1
BET1 homolog
Mus musculus
Gene Bet1, UniProt O35623
>NP_033878.1|Pseudomona aeruginosa PA01|BET1 homolog
MRRAGLGDGAPPGSYGNYGYANTGYNACEEENDRLTESLRSKVTAIKSLSIEIGHEVKNQNKLLAEMDSQFDSTTGFLGKTMGRLKILSRGSQTKLLCYMMLFSLFVFFVIYWIIKLR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.79 | -1.7910558387773 | 5.8e-7 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)