Host taxon 10090
Protein NP_001136431.1
bcl-2-like protein 15 isoform 1
Mus musculus
Gene Bcl2l15, UniProt Q08ED0
>NP_001136431.1|Pseudomona aeruginosa PA01|bcl-2-like protein 15 isoform 1
MSKMKNPRTFEEQTECIVNSLLKDFRTPLSHAANRNLSGADEPCSGEDYSFDVAIIVGRLRILGDQFNGELEASANNIIAVTIGGQAGSTVLNDTVQSLSRTWCTQDPTLVFERAFLAVSVKLLEYVVRKAPNVARQVANYVTGMINGNTAIREFIQGQGGWENLES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 6.22 | 6.21558546962362 | 0.00033 | 32071273 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)