Host taxon 10090
Protein NP_033884.1
bcl-2-like protein 11 isoform 3
Mus musculus
Gene Bcl2l11, UniProt O54918
>NP_033884.1|Pseudomona aeruginosa PA01|bcl-2-like protein 11 isoform 3
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.73 | 2.72871125889832 | 1.6e-209 | 32071273 | |
Retrieved 1 of 5 entries in 0.8 ms
(Link to these results)