Host taxon 10090
Protein NP_031549.2
bcl-2 homologous antagonist/killer
Mus musculus
Gene Bak1, UniProt O08734
>NP_031549.2|Pseudomona aeruginosa PA01|bcl-2 homologous antagonist/killer
MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.46 | -0.458382268183285 | 0.029 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)