Host taxon 10090
Protein NP_084336.1
basic leucine zipper transcriptional factor ATF-like 3
Mus musculus
Gene Batf3, UniProt Q9D275
>NP_084336.1|Pseudomona aeruginosa PA01|basic leucine zipper transcriptional factor ATF-like 3
MSQGPPAVSVLQRSVDAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLKEELRHLSEVLKEHEKMCPLLLCPMNFVQLRSDPVASCLPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.4 | 2.40467351759714 | 0.0027 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)