Host taxon 10090
Protein NP_001033320.1
barrier-to-autointegration factor
Mus musculus
Gene Banf1, UniProt O54962
>NP_001033320.1|Pseudomona aeruginosa PA01|barrier-to-autointegration factor
MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.8 | -0.803221935629573 | 0.01 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)